![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
![]() | Family d.1.1.0: automated matches [258602] (1 protein) not a true family |
![]() | Protein automated matches [258603] (2 species) not a true protein |
![]() | Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [258604] (2 PDB entries) |
![]() | Domain d3whoa_: 3who A: [258605] automated match to d3ahsa_ |
PDB Entry: 3who (more details), 1.85 Å
SCOPe Domain Sequences for d3whoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3whoa_ d.1.1.0 (A:) automated matches {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]} qtgvrscncagrsftgtdvtnairsaraggsgnyphvynnfegfsfsctptffefpvfrg svysggspgadrviydqsgrfcaclthtgapstngfvecrf
Timeline for d3whoa_: