Lineage for d3whoa_ (3who A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2924164Family d.1.1.0: automated matches [258602] (1 protein)
    not a true family
  6. 2924165Protein automated matches [258603] (2 species)
    not a true protein
  7. 2924170Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [258604] (2 PDB entries)
  8. 2924177Domain d3whoa_: 3who A: [258605]
    automated match to d3ahsa_

Details for d3whoa_

PDB Entry: 3who (more details), 1.85 Å

PDB Description: x-ray-crystallographic structure of an rnase po1 exhibiting anti-tumor activity
PDB Compounds: (A:) Guanyl-specific ribonuclease Po1

SCOPe Domain Sequences for d3whoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3whoa_ d.1.1.0 (A:) automated matches {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]}
qtgvrscncagrsftgtdvtnairsaraggsgnyphvynnfegfsfsctptffefpvfrg
svysggspgadrviydqsgrfcaclthtgapstngfvecrf

SCOPe Domain Coordinates for d3whoa_:

Click to download the PDB-style file with coordinates for d3whoa_.
(The format of our PDB-style files is described here.)

Timeline for d3whoa_: