Lineage for d3wfla_ (3wfl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833198Species Talaromyces trachyspermus [TaxId:28566] [258596] (1 PDB entry)
  8. 2833199Domain d3wfla_: 3wfl A: [258597]
    automated match to d1qnra_
    complexed with gol, nag, po4, trs

Details for d3wfla_

PDB Entry: 3wfl (more details), 1.6 Å

PDB Description: crtstal structure of glycoside hydrolase family 5 beta-mannanase from talaromyces trachyspermus
PDB Compounds: (A:) beta-mannanase

SCOPe Domain Sequences for d3wfla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wfla_ c.1.8.0 (A:) automated matches {Talaromyces trachyspermus [TaxId: 28566]}
tfpgtngldftidgtagyfagsnaywlafltnnddvdkvlgdaessglrimrvwgfndvn
tvpssgtvyfqllqdgtatintgsdglerldyvvssaeqhnvkliinfvnnwsdyggipa
yvnafggsttswytdeasqaayrnyiktvvsryidspavfawelaneprchgcdtsviyn
wvaatssfiksidsqhlvcigdeglgldidsdgsypysyyegtnftlnlgvdtidfgtfh
lypsswgvsnsfgspwvtahgaacaaagkpclfeeygvtsdkcsveggwqqtaldtrgig
adsfwqfgdtlstgqspndgytiyygtddytclvtdrvasi

SCOPe Domain Coordinates for d3wfla_:

Click to download the PDB-style file with coordinates for d3wfla_.
(The format of our PDB-style files is described here.)

Timeline for d3wfla_: