Lineage for d3wgcc_ (3wgc C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132241Species Aeromonas jandaei [TaxId:650] [258594] (2 PDB entries)
  8. 2132244Domain d3wgcc_: 3wgc C: [258595]
    automated match to d2fm1d_
    complexed with plg; mutant

Details for d3wgcc_

PDB Entry: 3wgc (more details), 2.5 Å

PDB Description: Aeromonas jandaei L-allo-threonine aldolase H128Y/S292R double mutant
PDB Compounds: (C:) L-allo-threonine aldolase

SCOPe Domain Sequences for d3wgcc_:

Sequence, based on SEQRES records: (download)

>d3wgcc_ c.67.1.0 (C:) automated matches {Aeromonas jandaei [TaxId: 650]}
ryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfvpsgt
msnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslaladvraa
iapddvyftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavvasgh
tvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagilaqagl
falqqhvvrladdhrrarqlaeglaalpgirldlaqvqtnmvflqltsgerapllafmka
rgilfsgygelrlvthlqihdddieevidafteyl

Sequence, based on observed residues (ATOM records): (download)

>d3wgcc_ c.67.1.0 (C:) automated matches {Aeromonas jandaei [TaxId: 650]}
ryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfvpsgt
msnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslaladvraa
iapddvyftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavvasgh
tvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagilaqagl
falqqhvvrladdhrrarqlaeglagirldlaqvqtnmvflqlrapllafmkargilfse
lrlvthlqihdddieevidafteyl

SCOPe Domain Coordinates for d3wgcc_:

Click to download the PDB-style file with coordinates for d3wgcc_.
(The format of our PDB-style files is described here.)

Timeline for d3wgcc_: