Lineage for d3wexc2 (3wex C:83-181)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755873Domain d3wexc2: 3wex C:83-181 [258593]
    Other proteins in same PDB: d3wexa1, d3wexc1, d3wexe1, d3wexg1
    automated match to d1f3ja1
    complexed with nag

Details for d3wexc2

PDB Entry: 3wex (more details), 2.4 Å

PDB Description: crystal structure of hla-dp5 in complex with cry j 1-derived peptide (residues 214-222)
PDB Compounds: (C:) MHC class II antigen

SCOPe Domain Sequences for d3wexc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wexc2 b.1.1.0 (C:83-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
andppevtvfpkepvelgqpntlichidrffppvlnvtwlcngepvtegvaeslflprtd
ysfhkfhyltfvpsaedvydcrvehwgldqpllkhweaq

SCOPe Domain Coordinates for d3wexc2:

Click to download the PDB-style file with coordinates for d3wexc2.
(The format of our PDB-style files is described here.)

Timeline for d3wexc2: