SCOPe 2.08: Domain d3wexe2: 3wex E:83-181

Lineage for d3wexe2 (3wex E:83-181)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3wexe2: 3wex E:83-181 [258591]
   Other proteins in same PDB: d3wexa1, d3wexc1, d3wexe1, d3wexg1
   automated match to d1f3ja1
   complexed with nag

Details for d3wexe2

PDB Entry: 3wex, 2.4 Å

PDB Description: crystal structure of hla-dp5 in complex with cry j 1-derived peptide (residues 214-222)

PDB Compounds: (E:) MHC class II antigen

SCOPe Domain Sequences for d3wexe2:

Sequence; same for both SEQRES and ATOM records:

>d3wexe2 b.1.1.0 (E:83-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
andppevtvfpkepvelgqpntlichidrffppvlnvtwlcngepvtegvaeslflprtd
ysfhkfhyltfvpsaedvydcrvehwgldqpllkhweaq

Timeline for d3wexe2:

• d3wexe2 first appeared in SCOPe 2.04
  
• d3wexe2 appears in SCOPe 2.07