Lineage for d3wexe1 (3wex E:1-82)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (67 PDB entries)
  8. 2507621Domain d3wexe1: 3wex E:1-82 [258590]
    Other proteins in same PDB: d3wexa2, d3wexc2, d3wexe2, d3wexg2
    automated match to d1f3ja2
    complexed with nag

Details for d3wexe1

PDB Entry: 3wex (more details), 2.4 Å

PDB Description: crystal structure of hla-dp5 in complex with cry j 1-derived peptide (residues 214-222)
PDB Compounds: (E:) MHC class II antigen

SCOPe Domain Sequences for d3wexe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wexe1 d.19.1.0 (E:1-82) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikadhvstyamfvqthrptgefmfefdedeqfyvdldkketvwhleefgrafsfeaqggl
aniailnnnlntliqrsnhtqa

SCOPe Domain Coordinates for d3wexe1:

Click to download the PDB-style file with coordinates for d3wexe1.
(The format of our PDB-style files is described here.)

Timeline for d3wexe1: