SCOP 1.71: Domain d1tni__: 1tni -

Lineage for d1tni__ (1tni -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (229 PDB entries)

8. Domain d1tni__: 1tni - [25859]
   complexed with ca, pbn

Details for d1tni__

PDB Entry: 1tni, 1.9 Å

PDB Description: prediction of novel serine protease inhibitors

SCOP Domain Sequences for d1tni__:

Sequence; same for both SEQRES and ATOM records:

>d1tni__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1tni__:

• d1tni__ first appeared (with stable ids) in SCOP 1.55
  
• d1tni__ appears in SCOP 1.69
  
• d1tni__ is called d1tnia_ in SCOP 1.73
  
• d1tni__ appears in the current release, SCOPe 2.08, called d1tnia_