SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3wd6b2 (3wd6 B:109-250)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1997413Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1997414Protein automated matches [226831] (58 species)
    not a true protein
  7. 1997720Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (8 PDB entries)
  8. 1997738Domain d3wd6b2: 3wd6 B:109-250 [258585]
    Other proteins in same PDB: d3wd6a1, d3wd6b1, d3wd6c1, d3wd6d1
    automated match to d3q18a2
    complexed with edo, gsh, iod, k, peg

Details for d3wd6b2

PDB Entry: 3wd6 (more details), 2.5 Å

PDB Description: Crystal structure of Bombyx mori omega-class glutathione transferase in complex with GSH
PDB Compounds: (B:) Omega-class glutathione S-transferase

SCOPe Domain Sequences for d3wd6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wd6b2 a.45.1.0 (B:109-250) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
lpqdplkkaldkiiveasapiqslfikilkfsdtvneehvaayhkaldfiqeqlknrgtv
fldgsepgyadymiwpwferlrafahdervrlepskysllleyidnmlkdsavsqylipl
eilakfheaytkkerpnyelln

SCOPe Domain Coordinates for d3wd6b2:

Click to download the PDB-style file with coordinates for d3wd6b2.
(The format of our PDB-style files is described here.)

Timeline for d3wd6b2: