| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (9 PDB entries) |
| Domain d3wd6d2: 3wd6 D:109-250 [258584] Other proteins in same PDB: d3wd6a1, d3wd6b1, d3wd6c1, d3wd6d1 automated match to d3q18a2 complexed with edo, gsh, iod, k, peg |
PDB Entry: 3wd6 (more details), 2.5 Å
SCOPe Domain Sequences for d3wd6d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wd6d2 a.45.1.0 (D:109-250) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
lpqdplkkaldkiiveasapiqslfikilkfsdtvneehvaayhkaldfiqeqlknrgtv
fldgsepgyadymiwpwferlrafahdervrlepskysllleyidnmlkdsavsqylipl
eilakfheaytkkerpnyelln
Timeline for d3wd6d2: