![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (195 species) not a true protein |
![]() | Species Silkworm (Bombyx mori) [TaxId:7091] [226183] (9 PDB entries) |
![]() | Domain d3wd6c1: 3wd6 C:10-108 [258580] Other proteins in same PDB: d3wd6a2, d3wd6b2, d3wd6c2, d3wd6d2 automated match to d3qaga1 complexed with edo, gsh, iod, k, peg |
PDB Entry: 3wd6 (more details), 2.5 Å
SCOPe Domain Sequences for d3wd6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wd6c1 c.47.1.0 (C:10-108) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]} infntkhlrkgdplppfngklrvynmrycpyaqrtilalnakqidyevvnidlidkpewl ttksafakvpaieiaedvtiyeslvtveyldevypkrpl
Timeline for d3wd6c1: