SCOP 1.71: Domain d1ntp__: 1ntp -

Lineage for d1ntp__ (1ntp -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (229 PDB entries)

8. Domain d1ntp__: 1ntp - [25858]
   complexed with mip

Details for d1ntp__

PDB Entry: 1ntp, 1.8 Å

PDB Description: use of the neutron diffraction h/d exchange technique to determine the conformational dynamics of trypsin

SCOP Domain Sequences for d1ntp__:

Sequence; same for both SEQRES and ATOM records:

>d1ntp__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslidsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsydsntlnndimliklksaasldsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1ntp__:

• d1ntp__ first appeared (with stable ids) in SCOP 1.55
  
• d1ntp__ appears in SCOP 1.69
  
• d1ntp__ is called d1ntpa_ in SCOP 1.73
  
• d1ntp__ appears in the current release, SCOPe 2.08, called d1ntpa_