Lineage for d4urnb_ (4urn B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974158Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries)
  8. 2974196Domain d4urnb_: 4urn B: [258574]
    automated match to d4hymb1
    complexed with nov

Details for d4urnb_

PDB Entry: 4urn (more details), 2.3 Å

PDB Description: Crystal Structure of Staph ParE 24kDa in complex with Novobiocin
PDB Compounds: (B:) DNA topoisomerase IV, B subunit

SCOPe Domain Sequences for d4urnb_:

Sequence, based on SEQRES records: (download)

>d4urnb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gstdkrglhhlvyeivdnsvdevlngygneidvtinkdgsisiedngrgmptgihksgkp
tveviftvlhaggkfgqggyktsgglhgvgasvvnalsewleveihrdgniyhqsfkngg
spssglvkkgktkktgtkvtfkpddtifkastsfnfdvlserlqesafllknlkitlndl
rsgkerqehyhy

Sequence, based on observed residues (ATOM records): (download)

>d4urnb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gstdkrglhhlvyeivdnsvdevlngygneidvtinkdgsisiedngrgmptgihksgkp
tveviftvlgvgasvvnalsewleveihrdgniyhqsfknggspssglvkkgktkktgtk
vtfkpddtifkastsfnfdvlserlqesafllknlkitlndlrsgkerqehyhy

SCOPe Domain Coordinates for d4urnb_:

Click to download the PDB-style file with coordinates for d4urnb_.
(The format of our PDB-style files is described here.)

Timeline for d4urnb_: