Lineage for d4uqia_ (4uqi A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2333069Family a.118.1.10: Clathrin adaptor core protein [74771] (3 protein domains)
    automatically mapped to Pfam PF01602
  6. 2333076Protein automated matches [190425] (2 species)
    not a true protein
  7. 2333082Species Norway rat (Rattus norvegicus) [TaxId:10116] [258572] (1 PDB entry)
  8. 2333083Domain d4uqia_: 4uqi A: [258573]
    Other proteins in same PDB: d4uqis_
    automated match to d2vgla_
    complexed with cl, ihp

Details for d4uqia_

PDB Entry: 4uqi (more details), 2.79 Å

PDB Description: AP2 controls clathrin polymerization with a membrane-activated switch
PDB Compounds: (A:) ap-2 complex subunit alpha-2

SCOPe Domain Sequences for d4uqia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uqia_ a.118.1.10 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gmrglavfisdirnckskeaeikrinkelanirskfkgdkaldgyskkkyvckllfifll
ghdidfghmeavnllssnrytekqigylfisvlvnsnselirlinnaikndlasrnptfm
glalhcianvgsremaeafageipkilvagdtmdsvkqsaalcllrlyrtspdlvpmgdw
tsrvvhllndqhlgvvtaatslittlaqknpeefktsvslavsrlsrivtsastdlqdyt
yyfvpapwlsvkllrllqcypppedpavrgrltecletilnkaqeppkskkvqhsnakna
vlfeaisliihhdsepnllvracnqlgqflqhretnlrylalesmctlassefsheavkt
hietvinalkterdvsvrqravdllyamcdrsnaqqivaemlsyletadysireeivlkv
ailaekyavdytwyvdtilnliriagdyvseevwyrviqivinrddvqgyaaktvfealq
apachenlvkvggyilgefgnliagdprsspliqfnllhskfhlcsvptralllstyikf
vnlfpevkatiqdvlrsdsqlknadvelqqraveylrlstvastdilatvleemppfper

SCOPe Domain Coordinates for d4uqia_:

Click to download the PDB-style file with coordinates for d4uqia_.
(The format of our PDB-style files is described here.)

Timeline for d4uqia_: