SCOPe 2.06: Domain d4uqis_: 4uqi S:

Lineage for d4uqis_ (4uqi S:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.4: SNARE-like [64356] (5 families)
   beta(2)-alpha-beta(3)-alpha(2)

5. Family d.110.4.2: Clathrin coat assembly domain [75521] (2 proteins)
   automatically mapped to Pfam PF01217

6. Protein Sigma2 adaptin (clathrin coat assembly protein AP17) [75524] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [75525] (5 PDB entries)

8. Domain d4uqis_: 4uqi S: [258571]
   Other proteins in same PDB: d4uqia_
   automated match to d2vgls_
   complexed with cl, ihp

Details for d4uqis_

PDB Entry: 4uqi, 2.79 Å

PDB Description: ap2 controls clathrin polymerization with a membrane-activated switch

PDB Compounds: (S:) ap-2 complex subunit sigma

SCOPe Domain Sequences for d4uqis_:

Sequence; same for both SEQRES and ATOM records:

>d4uqis_ d.110.4.2 (S:) Sigma2 adaptin (clathrin coat assembly protein AP17) {Mouse (Mus musculus) [TaxId: 10090]}
mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdakhtnfvefrnfkiiyr
ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla
geiretsqtkvlkqllmlqsle

Timeline for d4uqis_:

• d4uqis_ first appeared in SCOPe 2.04
  
• d4uqis_ appears in SCOPe 2.05
  
• d4uqis_ appears in SCOPe 2.07
  
• d4uqis_ appears in the current release, SCOPe 2.08