Lineage for d4uqis_ (4uqi S:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1922955Superfamily d.110.4: SNARE-like [64356] (5 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 1922968Family d.110.4.2: Clathrin coat assembly domain [75521] (2 proteins)
    automatically mapped to Pfam PF01217
  6. 1922972Protein Sigma2 adaptin (clathrin coat assembly protein AP17) [75524] (1 species)
  7. 1922973Species Mouse (Mus musculus) [TaxId:10090] [75525] (4 PDB entries)
  8. 1922977Domain d4uqis_: 4uqi S: [258571]
    Other proteins in same PDB: d4uqia_
    automated match to d2vgls_
    complexed with cl, ihp

Details for d4uqis_

PDB Entry: 4uqi (more details), 2.79 Å

PDB Description: ap2 controls clathrin polymerization with a membrane-activated switch
PDB Compounds: (S:) ap-2 complex subunit sigma

SCOPe Domain Sequences for d4uqis_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uqis_ d.110.4.2 (S:) Sigma2 adaptin (clathrin coat assembly protein AP17) {Mouse (Mus musculus) [TaxId: 10090]}
mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdakhtnfvefrnfkiiyr
ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla
geiretsqtkvlkqllmlqsle

SCOPe Domain Coordinates for d4uqis_:

Click to download the PDB-style file with coordinates for d4uqis_.
(The format of our PDB-style files is described here.)

Timeline for d4uqis_: