Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (24 species) not a true protein |
Species Influenza a virus [TaxId:560387] [258567] (1 PDB entry) |
Domain d4uo3a_: 4uo3 A: [258568] Other proteins in same PDB: d4uo3b_, d4uo3d_, d4uo3f_ automated match to d3hmga_ complexed with edo, nag; mutant |
PDB Entry: 4uo3 (more details), 2.87 Å
SCOPe Domain Sequences for d4uo3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uo3a_ b.19.1.2 (A:) automated matches {Influenza a virus [TaxId: 560387]} pisnnntatlclghhavangtlvktitddqievtnatelvqsismgkicnnsyrildgrn ctlidamlgdphcdvfqyenwdlfierssafsncypydipdyaslrsivassgtleftae gftwtgvtqngrsgackrgsadsffsrlnwltksgnsyptlnvtmpnnknfdklyiwgih hpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrpwvrgqsgrisiywtivkpgdil minsngnlvaprgyfklktgkssvmrsdvpidicvsecitpngsisnekpfqnvnkvtyg kcpkyirqntlklatgmrnvpek
Timeline for d4uo3a_: