Lineage for d4uo3a_ (4uo3 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778653Species Influenza a virus [TaxId:560387] [258567] (1 PDB entry)
  8. 1778654Domain d4uo3a_: 4uo3 A: [258568]
    Other proteins in same PDB: d4uo3b_, d4uo3d_, d4uo3f_
    automated match to d3hmga_
    complexed with edo, nag; mutant

Details for d4uo3a_

PDB Entry: 4uo3 (more details), 2.87 Å

PDB Description: structure of the a_equine_richmond_07 h3 haemagglutinin mutant ser30thr
PDB Compounds: (A:) h3 haemagglutinin ha1 chain

SCOPe Domain Sequences for d4uo3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uo3a_ b.19.1.2 (A:) automated matches {Influenza a virus [TaxId: 560387]}
pisnnntatlclghhavangtlvktitddqievtnatelvqsismgkicnnsyrildgrn
ctlidamlgdphcdvfqyenwdlfierssafsncypydipdyaslrsivassgtleftae
gftwtgvtqngrsgackrgsadsffsrlnwltksgnsyptlnvtmpnnknfdklyiwgih
hpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrpwvrgqsgrisiywtivkpgdil
minsngnlvaprgyfklktgkssvmrsdvpidicvsecitpngsisnekpfqnvnkvtyg
kcpkyirqntlklatgmrnvpek

SCOPe Domain Coordinates for d4uo3a_:

Click to download the PDB-style file with coordinates for d4uo3a_.
(The format of our PDB-style files is described here.)

Timeline for d4uo3a_: