Lineage for d4uoab_ (4uoa B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2267706Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2267707Protein automated matches [254645] (23 species)
    not a true protein
  7. 2267708Species Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258565] (4 PDB entries)
  8. 2267709Domain d4uoab_: 4uoa B: [258566]
    Other proteins in same PDB: d4uoaa_
    automated match to d4n5zb_
    complexed with nag, so4; mutant

Details for d4uoab_

PDB Entry: 4uoa (more details), 2.5 Å

PDB Description: structure of the a_canine_colorado_17864_06 h3 haemagglutinin met29ile mutant
PDB Compounds: (B:) ha2

SCOPe Domain Sequences for d4uoab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uoab_ h.3.1.0 (B:) automated matches {Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyvyrdealnnrfq

SCOPe Domain Coordinates for d4uoab_:

Click to download the PDB-style file with coordinates for d4uoab_.
(The format of our PDB-style files is described here.)

Timeline for d4uoab_: