Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (10 species) not a true protein |
Species Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258565] (4 PDB entries) |
Domain d4uoab_: 4uoa B: [258566] Other proteins in same PDB: d4uoaa_ automated match to d4n5zb_ complexed with nag, so4; mutant |
PDB Entry: 4uoa (more details), 2.5 Å
SCOPe Domain Sequences for d4uoab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uoab_ h.3.1.0 (B:) automated matches {Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]} gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyvyrdealnnrfq
Timeline for d4uoab_: