SCOPe 2.05: Domain d4uo1a_: 4uo1 A:

Lineage for d4uo1a_ (4uo1 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258558] (2 PDB entries)

8. Domain d4uo1a_: 4uo1 A: [258559]
   Other proteins in same PDB: d4uo1b_, d4uo1d_, d4uo1f_
   automated match to d3hmga_
   complexed with fuc, nag

Details for d4uo1a_

PDB Entry: 4uo1, 3 Å

PDB Description: structure of the a_equine_richmond_07 h3 haemagglutinin in complex with 3sln

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4uo1a_:

Sequence; same for both SEQRES and ATOM records:

>d4uo1a_ b.19.1.2 (A:) automated matches {Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]}
qnpisnnntatlclghhavangtlvktisddqievtnatelvqsismgkicnnsyrildg
rnctlidamlgdphcdvfqyenwdlfierssafsncypydipdyaslrsivassgtleft
aegftwtgvtqngrsgackrgsadsffsrlnwltksgnsyptlnvtmpnnknfdklyiwg
ihhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrpwvrgqsgrisiywtivkpgd
ilminsngnlvaprgyfklktgkssvmrsdvpidicvsecitpngsisnekpfqnvnkvt
ygkcpkyirqntlklatgmrnvpek

Timeline for d4uo1a_:

• d4uo1a_ first appeared in SCOPe 2.04
  
• d4uo1a_ appears in SCOPe 2.06
  
• d4uo1a_ appears in the current release, SCOPe 2.08