Lineage for d4uo1b_ (4uo1 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041498Species Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258556] (3 PDB entries)
  8. 3041502Domain d4uo1b_: 4uo1 B: [258557]
    Other proteins in same PDB: d4uo1a_, d4uo1c_, d4uo1e_
    automated match to d3vund_
    complexed with fuc, nag

Details for d4uo1b_

PDB Entry: 4uo1 (more details), 3 Å

PDB Description: structure of the a_equine_richmond_07 h3 haemagglutinin in complex with 3sln
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4uo1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uo1b_ h.3.1.1 (B:) automated matches {Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqtaidqineklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq

SCOPe Domain Coordinates for d4uo1b_:

Click to download the PDB-style file with coordinates for d4uo1b_.
(The format of our PDB-style files is described here.)

Timeline for d4uo1b_: