SCOPe 2.05: Domain d4unwa_: 4unw A:

Lineage for d4unwa_ (4unw A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258548] (2 PDB entries)

8. Domain d4unwa_: 4unw A: [258554]
   Other proteins in same PDB: d4unwb_, d4unwd_, d4unwf_
   automated match to d3hmga_
   complexed with nag

Details for d4unwa_

PDB Entry: 4unw, 2.6 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin

PDB Compounds: (A:) h3 haemagglutinin ha1 chain

SCOPe Domain Sequences for d4unwa_:

Sequence; same for both SEQRES and ATOM records:

>d4unwa_ b.19.1.2 (A:) automated matches {Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]}
nntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvldgrnctli
damlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtleftaegftw
tgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyiwgihhpss
nkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkpgdilmins
ngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnkitygkcpk
yirqntlklatgmrnvpekq

Timeline for d4unwa_:

• d4unwa_ first appeared in SCOPe 2.04
  
• d4unwa_ appears in SCOPe 2.06
  
• d4unwa_ appears in the current release, SCOPe 2.08