Lineage for d4unzb_ (4unz B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1969964Species Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258552] (2 PDB entries)
  8. 1969968Domain d4unzb_: 4unz B: [258553]
    Other proteins in same PDB: d4unza_, d4unzc_, d4unze_
    automated match to d3vund_
    complexed with nag

Details for d4unzb_

PDB Entry: 4unz (more details), 2.9 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin in complex with 6so4-sialyl lewis x
PDB Compounds: (B:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4unzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4unzb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfqi

SCOPe Domain Coordinates for d4unzb_:

Click to download the PDB-style file with coordinates for d4unzb_.
(The format of our PDB-style files is described here.)

Timeline for d4unzb_: