SCOPe 2.05: Domain d4unzc_: 4unz C:

Lineage for d4unzc_ (4unz C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258548] (2 PDB entries)

8. Domain d4unzc_: 4unz C: [258549]
   Other proteins in same PDB: d4unzb_, d4unzd_, d4unzf_
   automated match to d3hmga_
   complexed with nag

Details for d4unzc_

PDB Entry: 4unz, 2.9 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin in complex with 6so4-sialyl lewis x

PDB Compounds: (C:) hay subunit of haemagglutinin

SCOPe Domain Sequences for d4unzc_:

Sequence; same for both SEQRES and ATOM records:

>d4unzc_ b.19.1.2 (C:) automated matches {Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]}
pdqnptsgnntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvl
dgrnctlidamlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtle
ftaegftwtgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyi
wgihhpssnkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkp
gdilminsngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnk
itygkcpkyirqntlklatgmrnvpekqir

Timeline for d4unzc_:

• d4unzc_ first appeared in SCOPe 2.04
  
• d4unzc_ is called d4unzc1 in SCOPe 2.06
  
• d4unzc_ appears in the current release, SCOPe 2.08, called d4unzc1