Lineage for d4unzc_ (4unz C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531574Protein automated matches [190291] (23 species)
    not a true protein
  7. 1531577Species Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258548] (2 PDB entries)
  8. 1531580Domain d4unzc_: 4unz C: [258549]
    Other proteins in same PDB: d4unzb_
    automated match to d3hmga_
    complexed with nag

Details for d4unzc_

PDB Entry: 4unz (more details), 2.9 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin in complex with 6so4-sialyl lewis x
PDB Compounds: (C:) hay subunit of haemagglutinin

SCOPe Domain Sequences for d4unzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4unzc_ b.19.1.2 (C:) automated matches {Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]}
pdqnptsgnntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvl
dgrnctlidamlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtle
ftaegftwtgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyi
wgihhpssnkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkp
gdilminsngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnk
itygkcpkyirqntlklatgmrnvpekqir

SCOPe Domain Coordinates for d4unzc_:

Click to download the PDB-style file with coordinates for d4unzc_.
(The format of our PDB-style files is described here.)

Timeline for d4unzc_: