SCOPe 2.08: Domain d4unzc1: 4unz C:2-329

Lineage for d4unzc1 (4unz C:2-329)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (19 species)
   not a true protein

7. Species Influenza A virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258548] (2 PDB entries)

8. Domain d4unzc1: 4unz C:2-329 [258549]
   Other proteins in same PDB: d4unzb_, d4unzc2, d4unzd_, d4unzf_
   automated match to d3hmga_
   complexed with nag

Details for d4unzc1

PDB Entry: 4unz, 2.9 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin in complex with 6so4-sialyl lewis x

PDB Compounds: (C:) hay subunit of haemagglutinin

SCOPe Domain Sequences for d4unzc1:

Sequence; same for both SEQRES and ATOM records:

>d4unzc1 b.19.1.2 (C:2-329) automated matches {Influenza A virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]}
qnptsgnntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvldg
rnctlidamlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtleft
aegftwtgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyiwg
ihhpssnkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkpgd
ilminsngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnkit
ygkcpkyirqntlklatgmrnvpekqir

Timeline for d4unzc1:

• d4unzc1 first appeared in SCOPe 2.04, called d4unzc_
  
• d4unzc1 appears in SCOPe 2.07