Class a: All alpha proteins [46456] (290 folds) |
Fold a.292: HP0242-like [158751] (1 superfamily) multihelical; intertwined homodimer of four-helical subunits, forming catenated triangular ring-like structures; pseudo knot |
Superfamily a.292.1: HP0242-like [158752] (1 family) automatically mapped to Pfam PF09442 |
Family a.292.1.1: HP0242-like [158753] (1 protein) Pfam PF09442; DUF2018 |
Protein Hypothetical protein HP0242 [158754] (1 species) |
Species Helicobacter pylori [TaxId:210] [158755] (4 PDB entries) Uniprot O25025 1-93! Uniprot O25025 13-92 |
Domain d4u12a_: 4u12 A: [258543] automated match to d2oufa1 |
PDB Entry: 4u12 (more details), 1.94 Å
SCOPe Domain Sequences for d4u12a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u12a_ a.292.1.1 (A:) Hypothetical protein HP0242 {Helicobacter pylori [TaxId: 210]} npldkwndiifhaskklskkelerllellalletfiekedleekfesfakalrideelqq kiesrktdiviqsmanilsg
Timeline for d4u12a_: