SCOPe 2.04: Domain d4tvta_: 4tvt A:

Lineage for d4tvta_ (4tvt A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
   automatically mapped to Pfam PF00314

6. Protein Thaumatin [49876] (1 species)

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (50 PDB entries)
   Uniprot P02883

8. Domain d4tvta_: 4tvt A: [258539]
   automated match to d1kwna_
   complexed with asc, na, tla

Details for d4tvta_

PDB Entry: 4tvt, 1.2 Å

PDB Description: new ligand for thaumatin discovered using acoustic high throughput screening

PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d4tvta_:

Sequence; same for both SEQRES and ATOM records:

>d4tvta_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d4tvta_:

• d4tvta_ is new in SCOPe 2.04-stable
  
• d4tvta_ appears in SCOPe 2.05
  
• d4tvta_ appears in the current release, SCOPe 2.08