Lineage for d4tv4a_ (4tv4 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089236Fold b.157: Hcp1-like [141451] (1 superfamily)
    barrel, closed; n=6, S=12; contains extra, non-barrel strand 7 at the C-terminus
  4. 2089237Superfamily b.157.1: Hcp1-like [141452] (2 families) (S)
    probable biological unit is a ring-like hexamer containing a 24-stranded beta-barrel made of the subunit beta-sheets
  5. 2089244Family b.157.1.0: automated matches [191591] (1 protein)
    not a true family
  6. 2089245Protein automated matches [191065] (5 species)
    not a true protein
  7. 2089250Species Burkholderia pseudomallei [TaxId:320372] [258536] (1 PDB entry)
  8. 2089251Domain d4tv4a_: 4tv4 A: [258537]
    automated match to d1y12a1

Details for d4tv4a_

PDB Entry: 4tv4 (more details), 2.1 Å

PDB Description: crystal structure of a putative uncharacterized protein from burkholderia pseudomallei
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d4tv4a_:

Sequence, based on SEQRES records: (download)

>d4tv4a_ b.157.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
aqdiflkidgingeslddshkdeievlnwnweiqqestmhtgsgggagkasvkdltfeha
idraspnlmkyaltgkhvdqavlvmrkaggnpleylkltmsdviitrvrpsgsrddters
retvslsfakvkqeyvvqnaqggsggavttsfdikgnket

Sequence, based on observed residues (ATOM records): (download)

>d4tv4a_ b.157.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
aqdiflkidgingeslddshkdeievlnwnweiqqkasvkdltfehaidraspnlmkyal
tgkhvdqavlvmrkaggnpleylkltmsdviitrvrpsgsrddrsretvslsfakvkqey
vvqnaqggsggavttsfdikgnket

SCOPe Domain Coordinates for d4tv4a_:

Click to download the PDB-style file with coordinates for d4tv4a_.
(The format of our PDB-style files is described here.)

Timeline for d4tv4a_: