![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein automated matches [190224] (9 species) not a true protein |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [186985] (33 PDB entries) |
![]() | Domain d4tqqm_: 4tqq M: [258533] Other proteins in same PDB: d4tqqh1, d4tqqh2, d4tqql_ automated match to d2j8cm_ complexed with bcl, bph, fe2, u10, uq1 |
PDB Entry: 4tqq (more details), 2.5 Å
SCOPe Domain Sequences for d4tqqm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tqqm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn hg
Timeline for d4tqqm_: