Class b: All beta proteins [48724] (177 folds) |
Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (5 families) |
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
Protein automated matches [226918] (3 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [225170] (7 PDB entries) |
Domain d4tqqh2: 4tqq H:36-250 [258532] Other proteins in same PDB: d4tqqh1, d4tqql_, d4tqqm_ automated match to d2gmrh2 complexed with bcl, bph, fe2, u10, uq1 |
PDB Entry: 4tqq (more details), 2.5 Å
SCOPe Domain Sequences for d4tqqh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tqqh2 b.41.1.1 (H:36-250) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrks
Timeline for d4tqqh2: