SCOPe 2.06: Domain d4tqqh2: 4tqq H:36-250

Lineage for d4tqqh2 (4tqq H:36-250)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein automated matches [226918] (3 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [225170] (7 PDB entries)

8. Domain d4tqqh2: 4tqq H:36-250 [258532]
   Other proteins in same PDB: d4tqqh1, d4tqql_, d4tqqm_
   automated match to d2gmrh2
   complexed with bcl, bph, fe2, u10, uq1

Details for d4tqqh2

PDB Entry: 4tqq, 2.5 Å

PDB Description: photosynthetic reaction center from r. sphaeroides analyzed at room temperature on an x-ray transparent microfluidic chip

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d4tqqh2:

Sequence; same for both SEQRES and ATOM records:

>d4tqqh2 b.41.1.1 (H:36-250) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d4tqqh2:

• d4tqqh2 first appeared in SCOPe 2.04
  
• d4tqqh2 appears in SCOPe 2.05
  
• d4tqqh2 appears in SCOPe 2.07
  
• d4tqqh2 appears in the current release, SCOPe 2.08