Lineage for d4tqqh2 (4tqq H:36-250)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790502Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1790503Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1790504Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1790616Protein automated matches [226918] (3 species)
    not a true protein
  7. 1790622Species Rhodobacter sphaeroides [TaxId:1063] [225170] (7 PDB entries)
  8. 1790626Domain d4tqqh2: 4tqq H:36-250 [258532]
    Other proteins in same PDB: d4tqqh1, d4tqql_, d4tqqm_
    automated match to d2gmrh2
    complexed with bcl, bph, fe2, u10, uq1

Details for d4tqqh2

PDB Entry: 4tqq (more details), 2.5 Å

PDB Description: photosynthetic reaction center from r. sphaeroides analyzed at room temperature on an x-ray transparent microfluidic chip
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d4tqqh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tqqh2 b.41.1.1 (H:36-250) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

SCOPe Domain Coordinates for d4tqqh2:

Click to download the PDB-style file with coordinates for d4tqqh2.
(The format of our PDB-style files is described here.)

Timeline for d4tqqh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tqqh1