SCOP 1.73: Domain d1pphe_: 1pph E:

Lineage for d1pphe_ (1pph E:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (271 PDB entries)

8. Domain d1pphe_: 1pph E: [25853]
   complexed with apm, ca, pip, so4, tos

Details for d1pphe_

PDB Entry: 1pph, 1.9 Å

PDB Description: geometry of binding of the nalpha-tosylated piperidides of m-amidino-, p-amidino-and p-guanidino phenylalanine to thrombin and trypsin: x-ray crystal structures of their trypsin complexes and modeling of their thrombin complexes

PDB Compounds: (E:) Trypsin

SCOP Domain Sequences for d1pphe_:

Sequence; same for both SEQRES and ATOM records:

>d1pphe_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1pphe_:

• d1pphe_ first appeared (with stable ids) in SCOP 1.55
  
• d1pphe_ appears in SCOP 1.71
  
• d1pphe_ appears in SCOP 1.75
  
• d1pphe_ appears in the current release, SCOPe 2.08