SCOPe 2.04: Domain d4tlgb3: 4tlg B:275-397

Lineage for d4tlgb3 (4tlg B:275-397)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.132: Supernatant protein factor (SPF), C-terminal domain [101575] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll; similarity to the Nucleoplasmin-like/VP fold

4. Superfamily b.132.1: Supernatant protein factor (SPF), C-terminal domain [101576] (2 families)

5. Family b.132.1.0: automated matches [258521] (1 protein)
   not a true family

6. Protein automated matches [258522] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [258523] (2 PDB entries)

8. Domain d4tlgb3: 4tlg B:275-397 [258525]
   Other proteins in same PDB: d4tlga1, d4tlga2, d4tlgb1, d4tlgb2
   automated match to d1o6ua2
   complexed with 11a, edo

Details for d4tlgb3

PDB Entry: 4tlg, 1.77 Å

PDB Description: crystal structure of sec14-like protein 4 (sec14l4)

PDB Compounds: (B:) SEC14-like protein 4

SCOPe Domain Sequences for d4tlgb3:

Sequence, based on SEQRES records:

>d4tlgb3 b.132.1.0 (B:275-397) automated matches {Homo sapiens [TaxId: 9606]}
rlqyehtrsvgrgsslqveneilfpgcvlrwqfasdggdigfgvflktkmgeqqsaremt
evlpsqrynahmvpedgsltclqagvyvlrfdntysrmhakklsytvevllpdkaseetl
qsm

Sequence, based on observed residues (ATOM records):

>d4tlgb3 b.132.1.0 (B:275-397) automated matches {Homo sapiens [TaxId: 9606]}
rlqyehtrsvgrgsslqveneilfpgcvlrwqfasdggdigfgvflktkmgeqqsaremt
evlpsqrynahmvpedgsltclqagvyvlrfdntysrmakklsytvevllpdkaseetlq
sm

Timeline for d4tlgb3:

• d4tlgb3 is new in SCOPe 2.04-stable
  
• d4tlgb3 appears in SCOPe 2.05
  
• d4tlgb3 appears in the current release, SCOPe 2.08