Lineage for d4tlga3 (4tlg A:275-398)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1565036Fold b.132: Supernatant protein factor (SPF), C-terminal domain [101575] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll; similarity to the Nucleoplasmin-like/VP fold
  4. 1565037Superfamily b.132.1: Supernatant protein factor (SPF), C-terminal domain [101576] (2 families) (S)
  5. 1565047Family b.132.1.0: automated matches [258521] (1 protein)
    not a true family
  6. 1565048Protein automated matches [258522] (1 species)
    not a true protein
  7. 1565049Species Homo sapiens [TaxId:9606] [258523] (2 PDB entries)
  8. 1565051Domain d4tlga3: 4tlg A:275-398 [258524]
    Other proteins in same PDB: d4tlga1, d4tlga2, d4tlgb1, d4tlgb2
    automated match to d1o6ua2
    complexed with 11a, edo

Details for d4tlga3

PDB Entry: 4tlg (more details), 1.77 Å

PDB Description: crystal structure of sec14-like protein 4 (sec14l4)
PDB Compounds: (A:) SEC14-like protein 4

SCOPe Domain Sequences for d4tlga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tlga3 b.132.1.0 (A:275-398) automated matches {Homo sapiens [TaxId: 9606]}
rlqyehtrsvgrgsslqveneilfpgcvlrwqfasdggdigfgvflktkmgeqqsaremt
evlpsqrynahmvpedgsltclqagvyvlrfdntysrmhakklsytvevllpdkaseetl
qsmr

SCOPe Domain Coordinates for d4tlga3:

Click to download the PDB-style file with coordinates for d4tlga3.
(The format of our PDB-style files is described here.)

Timeline for d4tlga3: