SCOPe 2.02: Domain d3ptna_: 3ptn A:

Lineage for d3ptna_ (3ptn A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
   Uniprot P00760

8. Domain d3ptna_: 3ptn A: [25852]
   complexed with ca

Details for d3ptna_

PDB Entry: 3ptn, 1.7 Å

PDB Description: on the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography

PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d3ptna_:

Sequence; same for both SEQRES and ATOM records:

>d3ptna_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d3ptna_:

• d3ptna_ first appeared (with stable ids) in SCOP 1.55, called d3ptn__
  
• d3ptna_ appears in SCOPe 2.01
  
• d3ptna_ appears in SCOPe 2.03
  
• d3ptna_ appears in the current release, SCOPe 2.08