SCOP 1.69: Domain d3ptn__: 3ptn -

Lineage for d3ptn__ (3ptn -)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (229 PDB entries)

8. Domain d3ptn__: 3ptn - [25852]

Details for d3ptn__

PDB Entry: 3ptn, 1.7 Å

PDB Description: on the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography

SCOP Domain Sequences for d3ptn__:

Sequence; same for both SEQRES and ATOM records:

>d3ptn__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d3ptn__:

• d3ptn__ first appeared (with stable ids) in SCOP 1.55
  
• d3ptn__ appears in SCOP 1.67
  
• d3ptn__ appears in SCOP 1.71
  
• d3ptn__ appears in the current release, SCOPe 2.08, called d3ptna_