SCOPe 2.08: Domain d4tlgb1: 4tlg B:7-75

Lineage for d4tlgb1 (4tlg B:7-75)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families)

5. Family a.5.3.0: automated matches [227224] (1 protein)
   not a true family

6. Protein automated matches [226965] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [258515] (4 PDB entries)

8. Domain d4tlgb1: 4tlg B:7-75 [258517]
   Other proteins in same PDB: d4tlga2, d4tlga3, d4tlgb2, d4tlgb3
   automated match to d1olma1
   complexed with 11a, edo

Details for d4tlgb1

PDB Entry: 4tlg, 1.77 Å

PDB Description: crystal structure of sec14-like protein 4 (sec14l4)

PDB Compounds: (B:) SEC14-like protein 4

SCOPe Domain Sequences for d4tlgb1:

Sequence, based on SEQRES records:

>d4tlgb1 a.5.3.0 (B:7-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlspqqqealarfrenlqdllpilpnaddyfllrwlrarnfdlqksedmlrrhmefrkqq
dldnivtwq

Sequence, based on observed residues (ATOM records):

>d4tlgb1 a.5.3.0 (B:7-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlspqqqealarfrenlqdllpiladdyfllrwlrarnfdlqksedmlrrhmefrkqqdl
dnivtwq

Timeline for d4tlgb1:

• d4tlgb1 first appeared in SCOPe 2.04
  
• d4tlgb1 appears in SCOPe 2.07