Lineage for d4tlgb1 (4tlg B:7-75)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696232Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) (S)
  5. 2696251Family a.5.3.0: automated matches [227224] (1 protein)
    not a true family
  6. 2696252Protein automated matches [226965] (4 species)
    not a true protein
  7. 2696263Species Human (Homo sapiens) [TaxId:9606] [258515] (4 PDB entries)
  8. 2696270Domain d4tlgb1: 4tlg B:7-75 [258517]
    Other proteins in same PDB: d4tlga2, d4tlga3, d4tlgb2, d4tlgb3
    automated match to d1olma1
    complexed with 11a, edo

Details for d4tlgb1

PDB Entry: 4tlg (more details), 1.77 Å

PDB Description: crystal structure of sec14-like protein 4 (sec14l4)
PDB Compounds: (B:) SEC14-like protein 4

SCOPe Domain Sequences for d4tlgb1:

Sequence, based on SEQRES records: (download)

>d4tlgb1 a.5.3.0 (B:7-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlspqqqealarfrenlqdllpilpnaddyfllrwlrarnfdlqksedmlrrhmefrkqq
dldnivtwq

Sequence, based on observed residues (ATOM records): (download)

>d4tlgb1 a.5.3.0 (B:7-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlspqqqealarfrenlqdllpiladdyfllrwlrarnfdlqksedmlrrhmefrkqqdl
dnivtwq

SCOPe Domain Coordinates for d4tlgb1:

Click to download the PDB-style file with coordinates for d4tlgb1.
(The format of our PDB-style files is described here.)

Timeline for d4tlgb1: