Class a: All alpha proteins [46456] (285 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) |
Family a.5.3.0: automated matches [227224] (1 protein) not a true family |
Protein automated matches [226965] (3 species) not a true protein |
Species Homo sapiens [TaxId:9606] [258515] (2 PDB entries) |
Domain d4tlga1: 4tlg A:3-75 [258516] Other proteins in same PDB: d4tlga2, d4tlga3, d4tlgb2, d4tlgb3 automated match to d1olma1 complexed with 11a, edo |
PDB Entry: 4tlg (more details), 1.77 Å
SCOPe Domain Sequences for d4tlga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tlga1 a.5.3.0 (A:3-75) automated matches {Homo sapiens [TaxId: 9606]} srvgdlspqqqealarfrenlqdllpilpnaddyfllrwlrarnfdlqksedmlrrhmef rkqqdldnivtwq
Timeline for d4tlga1: