SCOPe 2.06: Domain d4qria_: 4qri A:

Lineage for d4qria_ (4qri A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (32 species)
   not a true protein

7. Species Leptospira interrogans [TaxId:267671] [258497] (1 PDB entry)

8. Domain d4qria_: 4qri A: [258507]
   automated match to d3h83a_
   complexed with peg, so4

Details for d4qria_

PDB Entry: 4qri, 2.35 Å

PDB Description: 2.35 angstrom resolution crystal structure of hypoxanthine-guanine- xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130

PDB Compounds: (A:) hypoxanthine-guanine-xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4qria_:

Sequence, based on SEQRES records:

>d4qria_ c.61.1.0 (A:) automated matches {Leptospira interrogans [TaxId: 267671]}
sdilhprfsredisqkvkslalqisedykklnpificvlkggvyfftdltreipfsvein
fvqarsysgtvstgkiellkdididlsdrhviivedildtgftlqylvrhiftrnpasle
ivtlllkerkdtlefpvkyigwripdeflvgygldfdgryrnlpdihvlep

Sequence, based on observed residues (ATOM records):

>d4qria_ c.61.1.0 (A:) automated matches {Leptospira interrogans [TaxId: 267671]}
sdilhprfsredisqkvkslalqisedykklnpificvlkggvyfftdltreipfsvein
fvqarkiellkdididlsdrhviivedildtgftlqylvrhiftrnpasleivtlllkee
fpvkyigwripdeflvgygldfdgryrnlpdihvlep

Timeline for d4qria_:

• d4qria_ first appeared in SCOPe 2.04
  
• d4qria_ appears in SCOPe 2.05
  
• d4qria_ appears in SCOPe 2.07
  
• d4qria_ appears in the current release, SCOPe 2.08