Lineage for d4qqea_ (4qqe A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2066122Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2066123Protein automated matches [190568] (6 species)
    not a true protein
  7. 2066160Species Human (Homo sapiens) [TaxId:9606] [187559] (46 PDB entries)
  8. 2066195Domain d4qqea_: 4qqe A: [258500]
    automated match to d2h9la_
    complexed with 37f, cl, edo, unx

Details for d4qqea_

PDB Entry: 4qqe (more details), 1.8 Å

PDB Description: Crystal structure of WDR5, WD repeat domain 5 in complex with compound SGC-DS-MT-0345
PDB Compounds: (A:) WD repeat-containing protein 5

SCOPe Domain Sequences for d4qqea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qqea_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

SCOPe Domain Coordinates for d4qqea_:

Click to download the PDB-style file with coordinates for d4qqea_.
(The format of our PDB-style files is described here.)

Timeline for d4qqea_: