Lineage for d1tgsz_ (1tgs Z:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15329Protein Trypsin(ogen) [50515] (6 species)
  7. 15330Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries)
  8. 15386Domain d1tgsz_: 1tgs Z: [25850]
    Other proteins in same PDB: d1tgsi_

Details for d1tgsz_

PDB Entry: 1tgs (more details), 1.8 Å

PDB Description: three-dimensional structure of the complex between pancreatic secretory inhibitor (kazal type) and trypsinogen at 1.8 angstroms resolution. structure solution, crystallographic refinement and preliminary structural interpretation

SCOP Domain Sequences for d1tgsz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgsz_ b.47.1.2 (Z:) Trypsin(ogen) {Cow (Bos taurus)}
dkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvv
egneqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqcli
sgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsg
gpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1tgsz_:

Click to download the PDB-style file with coordinates for d1tgsz_.
(The format of our PDB-style files is described here.)

Timeline for d1tgsz_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tgsi_