Lineage for d4qrib_ (4qri B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128696Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2128697Protein automated matches [190891] (32 species)
    not a true protein
  7. 2128829Species Leptospira interrogans [TaxId:267671] [258497] (1 PDB entry)
  8. 2128831Domain d4qrib_: 4qri B: [258498]
    automated match to d3h83a_
    complexed with peg, so4

Details for d4qrib_

PDB Entry: 4qri (more details), 2.35 Å

PDB Description: 2.35 angstrom resolution crystal structure of hypoxanthine-guanine- xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130
PDB Compounds: (B:) hypoxanthine-guanine-xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4qrib_:

Sequence, based on SEQRES records: (download)

>d4qrib_ c.61.1.0 (B:) automated matches {Leptospira interrogans [TaxId: 267671]}
sdilhprfsredisqkvkslalqisedykklnpificvlkggvyfftdltreipfsvein
fvqarsysgtvstgkiellkdididlsdrhviivedildtgftlqylvrhiftrnpasle
ivtlllkerkdtlefpvkyigwripdeflvgygldfdgryrnlpdihvlepg

Sequence, based on observed residues (ATOM records): (download)

>d4qrib_ c.61.1.0 (B:) automated matches {Leptospira interrogans [TaxId: 267671]}
sdilhprfsredisqkvkslalqisedykklnpificvlkggvyfftdltreipfsvein
fvqaiellkdididlsdrhviivedildtgftlqylvrhiftrnpasleivtlllkefpv
kyigwripdeflvgygldfdgryrnlpdihvlepg

SCOPe Domain Coordinates for d4qrib_:

Click to download the PDB-style file with coordinates for d4qrib_.
(The format of our PDB-style files is described here.)

Timeline for d4qrib_: