Lineage for d4qo8b2 (4qo8 B:160-331)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2998755Protein Lactate dehydrogenase [56339] (20 species)
  7. 2998826Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (39 PDB entries)
  8. 2998844Domain d4qo8b2: 4qo8 B:160-331 [258489]
    Other proteins in same PDB: d4qo8a1, d4qo8b1, d4qo8c1, d4qo8d1
    automated match to d1i10a2
    complexed with 36u, epe, lac, nai, so4

Details for d4qo8b2

PDB Entry: 4qo8 (more details), 2 Å

PDB Description: Lactate Dehydrogenase A in complex with substituted 3-Hydroxy-2-mercaptocyclohex-2-enone compound 104
PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4qo8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qo8b2 d.162.1.1 (B:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4qo8b2:

Click to download the PDB-style file with coordinates for d4qo8b2.
(The format of our PDB-style files is described here.)

Timeline for d4qo8b2: