Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [258485] (1 PDB entry) |
Domain d4qq7b2: 4qq7 B:79-202 [258486] Other proteins in same PDB: d4qq7a1, d4qq7a3, d4qq7b1, d4qq7b3 automated match to d3mdkb2 complexed with glo, gsh |
PDB Entry: 4qq7 (more details), 2.2 Å
SCOPe Domain Sequences for d4qq7b2:
Sequence, based on SEQRES records: (download)
>d4qq7b2 a.45.1.0 (B:79-202) automated matches {Burkholderia cenocepacia [TaxId: 216591]} lmpadpvqrararlfllnfekelfvhvstlenekgkaaeknhekarlairdrltqlapif vknkymlgeefsmldvaiapllwrldhygielsknaaplmkyaerifsrpayiealtpse kvmr
>d4qq7b2 a.45.1.0 (B:79-202) automated matches {Burkholderia cenocepacia [TaxId: 216591]} lmpadpvqrararlfllnfekelfvhvstleneeknhekarlairdrltqlapifvknky mlgeefsmldvaiapllwrldhygielsknaaplmkyaerifsrpayiealtpsekvmr
Timeline for d4qq7b2: