SCOPe 2.08: Domain d4qq7b2: 4qq7 B:79-202

Lineage for d4qq7b2 (4qq7 B:79-202)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [258485] (1 PDB entry)

8. Domain d4qq7b2: 4qq7 B:79-202 [258486]
   Other proteins in same PDB: d4qq7a1, d4qq7a3, d4qq7b1, d4qq7b3
   automated match to d3mdkb2
   complexed with glo, gsh

Details for d4qq7b2

PDB Entry: 4qq7, 2.2 Å

PDB Description: crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione

PDB Compounds: (B:) Putative stringent starvation protein A

SCOPe Domain Sequences for d4qq7b2:

Sequence, based on SEQRES records:

>d4qq7b2 a.45.1.0 (B:79-202) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
lmpadpvqrararlfllnfekelfvhvstlenekgkaaeknhekarlairdrltqlapif
vknkymlgeefsmldvaiapllwrldhygielsknaaplmkyaerifsrpayiealtpse
kvmr

Sequence, based on observed residues (ATOM records):

>d4qq7b2 a.45.1.0 (B:79-202) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
lmpadpvqrararlfllnfekelfvhvstleneeknhekarlairdrltqlapifvknky
mlgeefsmldvaiapllwrldhygielsknaaplmkyaerifsrpayiealtpsekvmr

Timeline for d4qq7b2:

• d4qq7b2 first appeared in SCOPe 2.04
  
• d4qq7b2 appears in SCOPe 2.07