Lineage for d4qq7b2 (4qq7 B:79-202)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713885Species Burkholderia cenocepacia [TaxId:216591] [258485] (1 PDB entry)
  8. 2713887Domain d4qq7b2: 4qq7 B:79-202 [258486]
    Other proteins in same PDB: d4qq7a1, d4qq7a3, d4qq7b1, d4qq7b3
    automated match to d3mdkb2
    complexed with glo, gsh

Details for d4qq7b2

PDB Entry: 4qq7 (more details), 2.2 Å

PDB Description: crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
PDB Compounds: (B:) Putative stringent starvation protein A

SCOPe Domain Sequences for d4qq7b2:

Sequence, based on SEQRES records: (download)

>d4qq7b2 a.45.1.0 (B:79-202) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
lmpadpvqrararlfllnfekelfvhvstlenekgkaaeknhekarlairdrltqlapif
vknkymlgeefsmldvaiapllwrldhygielsknaaplmkyaerifsrpayiealtpse
kvmr

Sequence, based on observed residues (ATOM records): (download)

>d4qq7b2 a.45.1.0 (B:79-202) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
lmpadpvqrararlfllnfekelfvhvstleneeknhekarlairdrltqlapifvknky
mlgeefsmldvaiapllwrldhygielsknaaplmkyaerifsrpayiealtpsekvmr

SCOPe Domain Coordinates for d4qq7b2:

Click to download the PDB-style file with coordinates for d4qq7b2.
(The format of our PDB-style files is described here.)

Timeline for d4qq7b2: