Lineage for d4qo4a_ (4qo4 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735235Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1735236Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1735237Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 1735244Protein MDM2 [47594] (2 species)
  7. 1735262Species Human (Homo sapiens) [TaxId:9606] [47596] (46 PDB entries)
  8. 1735316Domain d4qo4a_: 4qo4 A: [258480]
    automated match to d1t4ea_
    complexed with 35s

Details for d4qo4a_

PDB Entry: 4qo4 (more details), 1.7 Å

PDB Description: co-crystal structure of mdm2 (17-111) with compound 16, {(3r,5r,6s)-5-(3-chlorophenyl)-6-(4-chlorophenyl)-1-[(1s)-1-(6-cyclopropylpyridin-2-yl)propyl]-3-methyl-2-oxopiperidin-3-yl}acetic acid
PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4qo4a_:

Sequence, based on SEQRES records: (download)

>d4qo4a_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvv

Sequence, based on observed residues (ATOM records): (download)

>d4qo4a_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydhivycsndl
lgdlfgvpsfsvkehrkiytmiyrnlvvv

SCOPe Domain Coordinates for d4qo4a_:

Click to download the PDB-style file with coordinates for d4qo4a_.
(The format of our PDB-style files is described here.)

Timeline for d4qo4a_: