Lineage for d4qoaa_ (4qoa A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208076Fold d.98: BLIP-like [55647] (2 superfamilies)
    alpha(2)-beta(4); 2 layers: alpha/beta
  4. 2208116Superfamily d.98.2: BT0923-like [160574] (2 families) (S)
    Duplication: tandem repeat of two similar structural subdomains, which associate like the BLIP repeats but differ from them by transposition of the helices
  5. 2208128Family d.98.2.0: automated matches [195801] (1 protein)
    not a true family
  6. 2208129Protein automated matches [195802] (3 species)
    not a true protein
  7. 2208136Species Bacteroides uniformis [TaxId:411479] [258478] (1 PDB entry)
  8. 2208137Domain d4qoaa_: 4qoa A: [258479]
    automated match to d3elga1
    complexed with edo

Details for d4qoaa_

PDB Entry: 4qoa (more details), 2.75 Å

PDB Description: crystal structure of a putative periplasmic protein (bacuni_04550) from bacteroides uniformis atcc 8492 at 2.75 a resolution
PDB Compounds: (A:) Putative periplasmic protein

SCOPe Domain Sequences for d4qoaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qoaa_ d.98.2.0 (A:) automated matches {Bacteroides uniformis [TaxId: 411479]}
gdvitqdtkqlpltarnfinqyfskphishikieseilqtkkyevlltdrteidfdkkgn
wlevdckksavpealipvpvkeyvkanfpreiitkiergrtgveielgndyslkfnkkgk
fvsmdd

SCOPe Domain Coordinates for d4qoaa_:

Click to download the PDB-style file with coordinates for d4qoaa_.
(The format of our PDB-style files is described here.)

Timeline for d4qoaa_: