SCOPe 2.06: Domain d4qoaa_: 4qoa A:

Lineage for d4qoaa_ (4qoa A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.98: BLIP-like [55647] (2 superfamilies)
   alpha(2)-beta(4); 2 layers: alpha/beta

4. Superfamily d.98.2: BT0923-like [160574] (2 families)
   Duplication: tandem repeat of two similar structural subdomains, which associate like the BLIP repeats but differ from them by transposition of the helices

5. Family d.98.2.0: automated matches [195801] (1 protein)
   not a true family

6. Protein automated matches [195802] (3 species)
   not a true protein

7. Species Bacteroides uniformis [TaxId:411479] [258478] (1 PDB entry)

8. Domain d4qoaa_: 4qoa A: [258479]
   automated match to d3elga1
   complexed with edo

Details for d4qoaa_

PDB Entry: 4qoa, 2.75 Å

PDB Description: crystal structure of a putative periplasmic protein (bacuni_04550) from bacteroides uniformis atcc 8492 at 2.75 a resolution

PDB Compounds: (A:) Putative periplasmic protein

SCOPe Domain Sequences for d4qoaa_:

Sequence; same for both SEQRES and ATOM records:

>d4qoaa_ d.98.2.0 (A:) automated matches {Bacteroides uniformis [TaxId: 411479]}
gdvitqdtkqlpltarnfinqyfskphishikieseilqtkkyevlltdrteidfdkkgn
wlevdckksavpealipvpvkeyvkanfpreiitkiergrtgveielgndyslkfnkkgk
fvsmdd

Timeline for d4qoaa_:

• d4qoaa_ first appeared in SCOPe 2.04
  
• d4qoaa_ appears in SCOPe 2.05
  
• d4qoaa_ appears in SCOPe 2.07
  
• d4qoaa_ appears in the current release, SCOPe 2.08