![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.98: BLIP-like [55647] (2 superfamilies) alpha(2)-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.98.2: BT0923-like [160574] (2 families) ![]() Duplication: tandem repeat of two similar structural subdomains, which associate like the BLIP repeats but differ from them by transposition of the helices |
![]() | Family d.98.2.0: automated matches [195801] (1 protein) not a true family |
![]() | Protein automated matches [195802] (3 species) not a true protein |
![]() | Species Bacteroides uniformis [TaxId:411479] [258478] (1 PDB entry) |
![]() | Domain d4qoaa_: 4qoa A: [258479] automated match to d3elga1 complexed with edo |
PDB Entry: 4qoa (more details), 2.75 Å
SCOPe Domain Sequences for d4qoaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qoaa_ d.98.2.0 (A:) automated matches {Bacteroides uniformis [TaxId: 411479]} gdvitqdtkqlpltarnfinqyfskphishikieseilqtkkyevlltdrteidfdkkgn wlevdckksavpealipvpvkeyvkanfpreiitkiergrtgveielgndyslkfnkkgk fvsmdd
Timeline for d4qoaa_: