Lineage for d4qn3b_ (4qn3 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802176Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1802177Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1802178Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1802440Protein automated matches [193245] (15 species)
    not a true protein
  7. 1802461Species Influenza a virus (a/mallard/alb/196/1996(h10n7)) [TaxId:352589] [258467] (2 PDB entries)
  8. 1802463Domain d4qn3b_: 4qn3 B: [258476]
    automated match to d4mwua_
    complexed with ca, nag

Details for d4qn3b_

PDB Entry: 4qn3 (more details), 2.09 Å

PDB Description: Crystal structure of Neuraminidase N7
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d4qn3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qn3b_ b.68.1.1 (B:) automated matches {Influenza a virus (a/mallard/alb/196/1996(h10n7)) [TaxId: 352589]}
nylmlnkslckvegwvvvakdnairfgeseqiivtrepyvscdplgckmyalhqgttirn
khsngtihdrtafrglistplgsppivsnsdflcvgwsstschdgigrmticvqgnndna
tatvyydrrltttiktwagnilrtqesecvchngtcvvimtdgsassqaytkvlyfhkgl
vikeealkgsarhieecscyghnskvtcvcrdnwqganrpvieidmnamehtsqylctgv
ltdtsrpsdksigdcnnpitgspgapgvkgfgfldsgntwlgrtisprsrsgfemlkipn
agtdpnsriterqeivdnnnwsgysgsfidywdessecynpcfyvelirgrpeeakyvww
tsnslvalcgspvpvgsgsfpdgaqiqyfs

SCOPe Domain Coordinates for d4qn3b_:

Click to download the PDB-style file with coordinates for d4qn3b_.
(The format of our PDB-style files is described here.)

Timeline for d4qn3b_: