Lineage for d4qn7b_ (4qn7 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2064995Protein Influenza neuraminidase [50943] (4 species)
  7. 2065001Species Influenza a virus (a/mallard/alb/196/1996(h10n7)) [TaxId:352589] [311107] (2 PDB entries)
  8. 2065005Domain d4qn7b_: 4qn7 B: [258471]
    automated match to d4mwua_
    complexed with ca, g39, nag

Details for d4qn7b_

PDB Entry: 4qn7 (more details), 2.3 Å

PDB Description: Crystal structure of neuramnidase N7 complexed with Oseltamivir
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d4qn7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qn7b_ b.68.1.1 (B:) Influenza neuraminidase {Influenza a virus (a/mallard/alb/196/1996(h10n7)) [TaxId: 352589]}
nylmlnkslckvegwvvvakdnairfgeseqiivtrepyvscdplgckmyalhqgttirn
khsngtihdrtafrglistplgsppivsnsdflcvgwsstschdgigrmticvqgnndna
tatvyydrrltttiktwagnilrtqesecvchngtcvvimtdgsassqaytkvlyfhkgl
vikeealkgsarhieecscyghnskvtcvcrdnwqganrpvieidmnamehtsqylctgv
ltdtsrpsdksigdcnnpitgspgapgvkgfgfldsgntwlgrtisprsrsgfemlkipn
agtdpnsriterqeivdnnnwsgysgsfidywdessecynpcfyvelirgrpeeakyvww
tsnslvalcgspvpvgsgsfpdgaqiqyfs

SCOPe Domain Coordinates for d4qn7b_:

Click to download the PDB-style file with coordinates for d4qn7b_.
(The format of our PDB-style files is described here.)

Timeline for d4qn7b_: